PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G034500.1.p
Common NameSb03g003120, SORBIDRAFT_03g003120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 246aa    MW: 26067.4 Da    PI: 8.4636
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G034500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-171462148
                          TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                          rg+W++eEde l  +v+++G+g +W + +++ g++R++k+c++rw++yl
  Sobic.003G034500.1.p 14 RGPWSPEEDEALRSYVQRHGSGgNWIAMPKKAGLKRCGKSCRLRWLNYL 62
                          89*********************************************97 PP

2Myb_DNA-binding48.61.9e-1569111246
                           SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           g +T+eEd  ++ + +qlG++ W++Ia+ m  gRt++++k++w++
  Sobic.003G034500.1.p  69 GGFTAEEDAVILSLYTQLGSK-WSLIASQME-GRTDNDVKNHWNT 111
                           569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.365962IPR017930Myb domain
SuperFamilySSF466891.48E-2812109IPR009057Homeodomain-like
SMARTSM007171.6E-121364IPR001005SANT/Myb domain
PfamPF002491.9E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-241569IPR009057Homeodomain-like
CDDcd001675.30E-101662No hitNo description
PROSITE profilePS5129422.5263117IPR017930Myb domain
SMARTSM007171.9E-1167115IPR001005SANT/Myb domain
PfamPF002493.5E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-2370117IPR009057Homeodomain-like
CDDcd001676.26E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MGRTPCCDRA AVKRGPWSPE EDEALRSYVQ RHGSGGNWIA MPKKAGLKRC GKSCRLRWLN  60
YLRPDIRHGG FTAEEDAVIL SLYTQLGSKW SLIASQMEGR TDNDVKNHWN TKLKKRLLAA  120
AATSSPPPHA RLPAPAPASR TAHVSASSLF PSLAIPTVKT EAYTYDDFLA PALGDPFAAA  180
DGSTSAASAA SSASNWSTAD NGASEVSLFL LDFCAGPDLG AVAAADQLKL PGGYYYPLDS  240
SLSPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23141177108B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.177790.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794160.0HF679416.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB10 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455023.11e-180hypothetical protein SORBIDRAFT_03g003120
SwissprotQ9SJL74e-69RAX2_ARATH; Transcription factor RAX2
TrEMBLC5XLY81e-180C5XLY8_SORBI; Putative uncharacterized protein Sb03g003120
STRINGSb03g003120.11e-179(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.13e-62myb domain protein 36